DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and si:dkey-202e17.1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005170092.1 Gene:si:dkey-202e17.1 ZFINID:ZDB-GENE-060503-810 Length:316 Species:Danio rerio

Alignment Length:319 Identity:103/320 (32%)
Similarity:161/320 (50%) Gaps:32/320 (10%)


  Fly    17 FMAGFVLAFVLLLYVYDVSRVTPCWS--------STSTMTTA--TTARIEDGPPPRILCMVLTCP 71
            |::| |...:.|...|...:.|...|        ||...|.|  ..|.::.....|:||.|:|.|
Zfish    10 FLSG-VAVSIFLTITYSHVQKTRTSSFVRIARNISTVKHTVAQNRNATLDSSQKVRVLCWVMTQP 73

  Fly    72 ENVQSLARSVYETWGQRCSRLIFASSE--DYEPLGVVGVVEPTGGGYEDLWNKTREGFRHVWEHY 134
            :|:||..:.|:.|||:||..:::.:|:  |:..:| :.|.|    |...|:.||...|:::.:|:
Zfish    74 QNLQSRTQHVHATWGKRCDTILYMTSKNTDFPTIG-LNVSE----GRNQLYWKTIRAFQYIHKHH 133

  Fly   135 AGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNV-SYMSGGASYILSREALHRF 198
            ..|.||||||||||:||:|||:|.|.......|::||.:...:.. .||||||.|:||:|||.||
Zfish   134 LDDADWFLKADDDTFVVIENLRHSLSKHSSEDPLYFGRRFRPFVAQGYMSGGAGYVLSKEALRRF 198

  Fly   199 ATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDANYT 263
            ....  ::.:|....:  :||..||.||:.:.|...||.   |...:..|.|....||:......
Zfish   199 VKGF--ADGLCTHTTE--LEDVGMGQCMEKMKVEMGDSR---DVFGRQVFHPYPPGNYLVRQLRR 256

  Fly   264 IPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKV------FDPNQI 316
            ...|..:........|..|||:::::|||.:...|...|:..|||:.      |:|:::
Zfish   257 QRPWYLIYDHYTPVEGPGCCSDFAISFHYINAVEMHTLEYYTYHLRPYGYKYRFNPDEL 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 57/152 (38%)
si:dkey-202e17.1XP_005170092.1 Galactosyl_T <139..>229 CDD:304462 41/94 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158954517
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.