DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and T09E11.12

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001076611.1 Gene:T09E11.12 WormBaseID:WBGene00045103 Length:323 Species:Caenorhabditis elegans

Alignment Length:208 Identity:64/209 (31%)
Similarity:98/209 (47%) Gaps:17/209 (8%)


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVV--GVVEPTGGGYEDLWNKTR 124
            ::.|.|.|....:.....|:..||.:||....|.|......|.:.  .|.:.....|.||:.|:.
 Worm    79 QLFCFVETSERYMDERVPSIASTWLRRCDNGRFFSKTPLLNLNITYSTVYKNLEDSYSDLFRKSI 143

  Fly   125 EGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGASYI 189
            .||.:.:.|.:..:||:||||||||..|::|:..|...||:.|::.|||.     .|.|||:.||
 Worm   144 FGFYYSYVHISKSFDWYLKADDDTYFAMDHLREYLNTLDPSKPLYLGYKN-----GYNSGGSGYI 203

  Fly   190 LSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLE 254
            ||..|:..|..::|..|..||..   ..||..:|.|:..||::..|:......::...|.|.:|.
 Worm   204 LSNAAVKLFVEKSYHDEYGCPYD---WAEDHGIGRCLARVGIYPTDTRDDKGLNSFVPFKPSELA 265

  Fly   255 NYMSDANYTIPEW 267
            .:.       |:|
 Worm   266 EFG-------PDW 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 52/151 (34%)
T09E11.12NP_001076611.1 Galactosyl_T <130..246 CDD:304462 46/124 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88701631
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.