DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and CG34057

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster


Alignment Length:382 Identity:119/382 - (31%)
Similarity:173/382 - (45%) Gaps:95/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTT----------------ATTARI 55
            :|:.:.|:.|.|.|..|.        |.......|.:.....:                ||..|.
  Fly    22 IRNIIFLVLGIMLGIRLT--------DFIGYLKLWRNNDLRASEKAALLKYPVASEEHLATWLRR 78

  Fly    56 EDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLW 120
            |    .||||:|||.|.:..:.|..|..|||.||::|||.||:....|.::.:.:  ....::|:
  Fly    79 E----VRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINK--SESRKNLY 137

  Fly   121 NKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSG 184
            .|.|.|..:|.:||..:||||||||||||:|||||:..|..:||.:.|:||.:...| :..||||
  Fly   138 AKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSG 202

  Fly   185 GASYILSREALHRFATQAYESEVICPQPKKMG-IEDFYMGICMQNVGVHFVDSTHALDGDTKP-- 246
            |..|:|||:||.|....|..|..||   |..| .||..:|.|:|:|||        :.|||:.  
  Fly   203 GGGYVLSRDALRRLNLFALNSTTIC---KLNGESEDVQIGHCLQDVGV--------IAGDTRDFQ 256

  Fly   247 ---KFMPLD-------------LENYM------SDANYTIPEWLRLMSLSRVETGLACCSNYSVA 289
               :|:|::             ||.|.      ||                      ||:..:::
  Fly   257 GHHRFLPVNPFTVFPTILSNSWLEGYFFHKPNKSD----------------------CCAASAIS 299

  Fly   290 FHYASRERMFLYEFLIYHLKVFDPNQISERGHRSRLTLSDLTRRF-----PLEDNSN 341
            |||.......|:||.:|:::||..:: :.|...|||....:..|.     .:.||.|
  Fly   300 FHYVKDFEFELFEFFLYYMRVFGLHR-TPRALPSRLGFRQMNERLQHWSQQVTDNKN 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 66/150 (44%)
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 66/154 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458863
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.