DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and B3glct

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001074673.1 Gene:B3glct MGIID:2685903 Length:489 Species:Mus musculus

Alignment Length:284 Identity:69/285 (24%)
Similarity:108/285 (38%) Gaps:65/285 (23%)


  Fly    17 FMAGFVLAFVLL-------------------------LYVYDVS---RVTP----CWSSTS--TM 47
            |.||:.|:..|:                         ||::|..   .:||    |.....  .:
Mouse   177 FAAGWALSIPLVNKLAKRLKSEALKSDFTIDLKHEIALYIWDKGGGPALTPVPEFCTEDVDPRCV 241

  Fly    48 TTATTARIEDGPPPR---ILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGV- 108
            ||..:.....|.|.:   |...|.||.:........|.:||..:.|.:.:.|  ||....:..| 
Mouse   242 TTFHSFLPLCGVPVKKEEIFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYS--DYAETAIPTVD 304

  Fly   109 --VEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVF-- 169
              :..|..|:   ..||.........|......|.:..||||.:.:..|:|||..:|.:.|||  
Mouse   305 LGIPNTDRGH---CGKTFAILEKFLNHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLG 366

  Fly   170 --FGYKMSRYNVSYMSGGASYILSREALHRF---ATQAYESEVICPQPKKMGIEDFYMGICMQNV 229
              :||.:.....||::||...:.||||:.|.   :.:.|.::.    |     :|..:|:|...:
Mouse   367 ERYGYGLGTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDA----P-----DDMVLGMCFSGL 422

  Fly   230 GVHFVDSTHA-LDGDTKPKFMPLD 252
            |   |..||: |....:|...|.|
Mouse   423 G---VPVTHSPLFHQARPVDYPKD 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 41/159 (26%)
B3glctNP_001074673.1 Galactosyl_T 255..457 CDD:304462 54/207 (26%)
Prevents secretion from ER. {ECO:0000255|PROSITE-ProRule:PRU10138} 486..489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.