DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and CG34056

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001033979.1 Gene:CG34056 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster

Alignment Length:350 Identity:123/350 (35%)
Similarity:185/350 (53%) Gaps:35/350 (10%)


  Fly     8 RSQLHLLTGFMAG-----FVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDGPPPRILCMV 67
            |:.|.|:.|.:.|     |:..|.|....:..:.:|......|.:.|.....:......|:||||
  Fly     3 RNILCLVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGASQLATEEELALWLHNETRVLCMV 67

  Fly    68 LTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYED---LWNKTREGFRH 129
            ||.|:|.||..|.|..|||:||::|||.||::...|||:.|..|     ||   |:.|.|:...:
  Fly    68 LTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVP-----EDRNNLYLKMRKALEY 127

  Fly   130 VWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKM-SRYNVSYMSGGASYILSRE 193
            |:.::..||||||||||||:|:||||:.||..:||...::||::. :.:...||||||.|::||:
  Fly   128 VYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGYMSGGAGYVMSRD 192

  Fly   194 ALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMS 258
            ||.|....|:.:...||.....  ||..:|.|:|||||...||.   |.:.:.:|:||.|:..:.
  Fly   193 ALRRLNLFAFNNSQFCPINNNS--EDRQIGFCLQNVGVVAGDSR---DEEGRDRFLPLSLKFMLP 252

  Fly   259 DANYTIP--EWLRLMSLSRV--ETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISER 319
                |.|  .||..::....  |||    |...::|||.......:||:|:|.|.:|. ..:|:|
  Fly   253 ----TFPTDNWLPKLTFYEPVNETG----STSGISFHYVKIHEFEMYEYLLYRLHIFG-TPLSQR 308

  Fly   320 GHRSRL---TLSDLTRRFPLEDNSN 341
            ....||   .|.:...::..|:::|
  Fly   309 TLPPRLGPDELQNQLNQWAQENSTN 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 66/153 (43%)
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 74/166 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158951368
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.