DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and CG8708

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_610360.2 Gene:CG8708 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster

Alignment Length:398 Identity:129/399 (32%)
Similarity:191/399 (48%) Gaps:74/399 (19%)


  Fly     4 KMKLRSQLHLLTGFMAGFVLAFVL-------LLYVYDVSRVTPCWSSTSTMTTATTARIEDG--- 58
            :.|.||...|:.|.:.|:.||.:.       .||.|...|    :|.:...|....|..:.|   
  Fly    17 RSKNRSVFTLIAGLVVGYCLAQIFSSIAPHESLYPYLSRR----FSDSQVATGGQLAPEQSGLKH 77

  Fly    59 --------------PPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVV 109
                          ...||||.|:|.|.|.:..||.|..|||:||:.|:|.||...|.|..|.: 
  Fly    78 DHRNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKL- 141

  Fly   110 EPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKM 174
             ..|.|.|:||.|.:|.|::|:.|:..|.|:|.|||||||.|:||::::|..::|.|||.||:|.
  Fly   142 -DVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKF 205

  Fly   175 SRY-NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTH 238
            ..: ...||||||.||||||||.||..:...:..:| .|..:..||..:|.||:|:.|...||..
  Fly   206 KPFVKQGYMSGGAGYILSREALRRFVVEGIPNPKMC-LPGTVVNEDIEIGRCMENLNVTAGDSRD 269

  Fly   239 ALDGDTKPKFMPLDLENYM----SDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMF 299
            .:.......|:|   |:::    :|.|:    |.......:.:.||.|||:.:::|||.:....:
  Fly   270 EIGRGRMFPFIP---EHHLIPAKADKNF----WYWNYLYYKTDDGLDCCSDLAISFHYVAPNSFY 327

  Fly   300 LYEFLIYHLK------------------VFDPNQISERGHRSRLTLSDLTRRFPLEDNSNIKDLL 346
            :.::||||||                  .|.|..:..||   ||..:        ||:::..|.:
  Fly   328 VLDYLIYHLKPYGLLRSLEPLPAKLKVGQFLPPPVEARG---RLASN--------EDSADDYDRI 381

  Fly   347 --QMSEKP 352
              ..:|||
  Fly   382 YTTTTEKP 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 66/150 (44%)
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88690450
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.