DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and C1GalTA

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_609258.1 Gene:C1GalTA FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster

Alignment Length:352 Identity:121/353 (34%)
Similarity:182/353 (52%) Gaps:55/353 (16%)


  Fly     8 RSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIED-----------GPPP 61
            ||.:.|:.|.:.||.||   .|:||.    ||..|............:.|           ||..
  Fly    20 RSFVSLIVGLIVGFCLA---ELFVYS----TPERSEFMPYDGHRHGDVNDAHHSHDMMEMSGPEQ 77

  Fly    62 ----------------------RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLG 104
                                  |:||.::|.|.|.|..||.|..|||:||::|||.||...:.|.
  Fly    78 DVGGHEHVHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDELD 142

  Fly   105 VVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVF 169
            .|.:  |.|.|..:||.||:|.:::::||:..|.|||||||||||.::||::::|..:.|.|||:
  Fly   143 AVAL--PVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVY 205

  Fly   170 FGYKMSRY-NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHF 233
            ||.|...| ...||||||.|:|||||:.||..:|..:..:| :....|.||..:|.|:|||.|..
  Fly   206 FGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEALPNPKLC-KSDNSGAEDVEIGKCLQNVNVLA 269

  Fly   234 VDSTHALDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERM 298
            .||.   |.:.:.:|.|...|:::..::.....|.......:.:.||.|||:.:::|||.|..:|
  Fly   270 GDSR---DSNGRGRFFPFVPEHHLIPSHTDKKFWYWQYIFYKTDEGLDCCSDNAISFHYVSPNQM 331

  Fly   299 FLYEFLIYHLKVFD--------PNQIS 317
            ::.::|||||:.:.        ||:::
  Fly   332 YVLDYLIYHLRPYGIINTPDALPNKLA 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 68/150 (45%)
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 69/149 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88690418
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.