DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and CG9109

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001285650.1 Gene:CG9109 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster

Alignment Length:160 Identity:37/161 (23%)
Similarity:56/161 (35%) Gaps:39/161 (24%)


  Fly   137 DYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNV--------------------SY 181
            |..|.:..||||.:.:    ||:....|.:.......:.|:|.                    :|
  Fly   348 DIRWLMLVDDDTLLSL----HLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNY 408

  Fly   182 MSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGV---HFVDSTHALDGD 243
            .:|||..:||. .|.|...|.      |..|.....:|..:|.|:|.:||   |......|...|
  Fly   409 HTGGAGIVLSL-PLVRLIVQR------CSCPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQD 466

  Fly   244 TKPKFM----PLDLENYM-SDANYTIPEWL 268
            ...:.:    ||....:. :|..:|...||
  Fly   467 YAGELLQLHAPLTFHKFWNTDPEHTYRRWL 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 29/121 (24%)
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 33/149 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.