DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and c1galt1b

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_956345.1 Gene:c1galt1b ZFINID:ZDB-GENE-030131-9075 Length:374 Species:Danio rerio

Alignment Length:296 Identity:103/297 (35%)
Similarity:159/297 (54%) Gaps:26/297 (9%)


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            ||||.|:|.|:|::..||.|..||.:.|:.::|.||.|......||:  .|..|.:.|:.||...
Zfish    88 RILCWVMTGPDNLEKKARHVKATWSRHCNIVVFISSVDNPDFPTVGL--NTKEGRDQLYWKTIRA 150

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSGGASYIL 190
            |.:|.|.::.:.||||||||||||:::||:.:|....|..||:||.:...| ...||||||.|:|
Zfish   151 FHYVMEKHSDEADWFLKADDDTYVIVDNLRWILARHSPEDPVYFGRRFKPYVKQGYMSGGAGYVL 215

  Fly   191 SREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLEN 255
            |:|||.|| .:.:.::| |..  ...:||..||.||:.:||...||...:..:|...|:|   |:
Zfish   216 SKEALRRF-VEGFRTKV-CTH--TTSVEDLAMGQCMEKIGVKAGDSRDTMQRETFHPFVP---ES 273

  Fly   256 YMSDANYTIPE--WLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISE 318
            :::.   |.|:  |........:..|..|||:.:|:|||.....|:|.|:..|||:.|       
Zfish   274 HLTG---TFPKTFWYWNYCYYPIVQGPQCCSDLAVSFHYVDASHMYLLEYYTYHLRAF------- 328

  Fly   319 RGHRSRLTLSDLTRRFPLEDNSNI---KDLLQMSEK 351
             |::.|....:...:.|.:..:.:   ||.::..|:
Zfish   329 -GYKYRYQPPEPNVKAPEKVETRVLEQKDKVEAQEE 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 60/150 (40%)
c1galt1bNP_956345.1 Galactosyl_T 107..274 CDD:304462 69/176 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158954427
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.