DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and CG2983

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_608723.2 Gene:CG2983 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster

Alignment Length:319 Identity:100/320 (31%)
Similarity:159/320 (50%) Gaps:27/320 (8%)


  Fly     2 TAKMKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDGPPPRILCM 66
            |:....|..|.||.|...|:::..||:..:.|:.      |.|:....:|:..|:.....|:||.
  Fly    20 TSPSTARPVLFLLLGIGIGYLITKVLVWPIMDLK------SHTNRTGASTSLDIDLTDEVRVLCY 78

  Fly    67 VLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVE-PTGGGYEDLWNKTREGFRHV 130
            |.|.|.|.::.|::|.||||:||::|||.||.  ..|.:.|.|| |....:.:.|.||:...:::
  Fly    79 VYTKPINHKTQAQAVLETWGRRCNKLIFFSSR--SDLNLTGSVELPVSPYFRESWLKTKMALKYL 141

  Fly   131 WEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGASYILSREAL 195
            .:|:..|.||||:|||:||||||||::::..:.|...::||           |.|.  ::||.||
  Fly   142 HDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG-----------SPGT--VMSRAAL 193

  Fly   196 HRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFM-PLDLENYMSD 259
            .|....:..:...|.| |..|.....:..|::||.| ...:|:..:|..:...: |....|..  
  Fly   194 RRLVELSLPNPSKCEQ-KNAGPTAEKLRECLENVNV-LAGNTYDSEGRRRMYLIEPQARSNLF-- 254

  Fly   260 ANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISE 318
            .:|....|.......|.:.|:...|||:|:|||.....:..:|::||.|:.|...||.|
  Fly   255 LHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQIVE 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 51/150 (34%)
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 42/111 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699662
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.