DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and c1galt1c1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_955961.2 Gene:c1galt1c1 ZFINID:ZDB-GENE-030131-2772 Length:317 Species:Danio rerio

Alignment Length:284 Identity:70/285 (25%)
Similarity:135/285 (47%) Gaps:39/285 (14%)


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            |:.|:::..|:.:...| :..:||.:.|.:.:|.:||..:.|..|.:.|      :|.|.:.|:.
Zfish    68 RVYCLIMVTPKLLVHWA-TANDTWSKHCDKSVFYTSEASKALDAVDLQE------QDEWTRLRKA 125

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGASYILS 191
            .:|.:|: |||..||..|...|:.::|||::|:...||:.|.:.|:......:.|:...:..:||
Zfish   126 IQHAYEN-AGDLHWFFIARPTTFAIIENLKYLVLDKDPSQPFYIGHTEKSGELDYVEYDSGIVLS 189

  Fly   192 REALHRFATQAYESEVICPQPK----KMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLD 252
            .||:.|. .:.::.|..||:..    ||. |:..:..|::..|| |.::..  |...|..|....
Zfish   190 YEAMRRL-MEVFKDEDKCPERGRALWKMS-EEKQLATCLKYSGV-FAENGE--DAQGKGLFNKKS 249

  Fly   253 LENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQIS 317
            :.:.:||:          :|.:..:...||||:.::.|...|..::.:..:.:|.|:.:      
Zfish   250 VSSLISDS----------ISQNPGDVVEACCSDMAITFAGMSPSQIQVLMYGVYRLRPY------ 298

  Fly   318 ERGHRSRLTLSDLTRRFPLEDNSN 341
              ||....:|:.|    |.:|:.|
Zfish   299 --GHDFHDSLTFL----PPKDSDN 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 43/153 (28%)
c1galt1c1NP_955961.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.