DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001025204.1 Gene:C1galt1c1 / 302499 RGDID:1311230 Length:316 Species:Rattus norvegicus


Alignment Length:277 Identity:74/277 - (26%)
Similarity:132/277 - (47%) Gaps:40/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGY 116
            |.|:|.....::.|:||..|::| ||..:|.|||.:.|.:..|.|||:      |.|.|......
  Rat    56 TERMELSKSFQVYCIVLVKPKDV-SLWAAVKETWTKHCDKAEFFSSEN------VKVFESINMDT 113

  Fly   117 EDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSY 181
            .|:|...|:.:::.::.|...|:||..|...|:.|:|||::.|...||:.|.:.|:.:...::.|
  Rat   114 NDMWLMMRKAYKYAYDKYKDQYNWFFLARPTTFAVIENLKYFLLRKDPSQPFYLGHTVKSGDLEY 178

  Fly   182 MSGGASYILSREALHRFATQAYESEVICPQ--PKKMGI-----EDFYMGICMQNVGVHFVDSTHA 239
            :|.....:||.|::.|.     ...:..|:  |::.|:     ||..:.:|::..||.   :.:|
  Rat   179 VSVDGGIVLSIESMKRL-----NGLLSVPEKCPEQGGMIWKISEDKQLAVCLKYAGVF---AENA 235

  Fly   240 LDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFL 304
            .|.|.|..|....:..::.:|....|        ::|..|  |||:.:|.|:..:..:|.:..:.
  Rat   236 EDADGKDVFNTKSVGLFIKEAMTNQP--------NQVVEG--CCSDMAVTFNGLTPNQMHVMMYG 290

  Fly   305 IYHLKVFDPNQISERGH 321
            :|.|:.|        ||
  Rat   291 VYRLRAF--------GH 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 40/155 (26%)
C1galt1c1NP_001025204.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.