DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:275 Identity:73/275 - (26%)
Similarity:129/275 - (46%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYED 118
            |:|.....|:.|::|..|::| ||..:|.|||.:.|.:..|.|||:      |.|.|.......|
Human    60 RMELSKSFRVYCIILVKPKDV-SLWAAVKETWTKHCDKAEFFSSEN------VKVFESINMDTND 117

  Fly   119 LWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMS 183
            :|...|:.:::.::.|...|:||..|...|:.::|||::.|...||:.|.:.|:.:...::.|:.
Human   118 MWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVG 182

  Fly   184 GGASYILSREALHRFATQAYESEVICPQ--PKKMGI-----EDFYMGICMQNVGVHFVDSTHALD 241
            .....:||.|::.|.     .|.:..|:  |::.|:     ||..:.:|::..|| |.::....|
Human   183 MEGGIVLSVESMKRL-----NSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGV-FAENAEDAD 241

  Fly   242 GDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIY 306
            |.        |:.|..| ...:|.|.:.......||   .|||:.:|.|:..:..:|.:..:.:|
Human   242 GK--------DVFNTKS-VGLSIKEAMTYHPNQVVE---GCCSDMAVTFNGLTPNQMHVMMYGVY 294

  Fly   307 HLKVFDPNQISERGH 321
            .|:.|        ||
Human   295 RLRAF--------GH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 40/155 (26%)
C1GALT1C1NP_001011551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.