DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and bus-4

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_500615.2 Gene:bus-4 WormBaseID:WBGene00044620 Length:368 Species:Caenorhabditis elegans

Alignment Length:365 Identity:93/366 (25%)
Similarity:164/366 (45%) Gaps:65/366 (18%)


  Fly     7 LRSQLHLLTGFMAGFVLAFVLLL----YVYDVSRVT--------PCWSS---------TSTMTTA 50
            |||.......:....::.|::|.    ::|.|...|        |...|         ..::..:
 Worm    22 LRSMRLCADEYRLSLIIVFIILFFGAYFLYQVQYKTGIDLIPLFPIDDSGFENYNEQLLGSVKVS 86

  Fly    51 TTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRC-SRLIFASSEDY----EPLGVV--GV 108
            .:|| .......:||..:|.....::...::.|||.:|| :..:|.:|:.:    .|...|  |:
 Worm    87 ESAR-NQAKSGSLLCWAMTTSIYHKTRVPAITETWLRRCDAGHLFTNSDRFLNASTPYHTVFDGL 150

  Fly   109 VEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYK 173
            .|    .|..|:.|||....:::::.:.|:||:.|.|||||:::||||..|...|||.|.|.||:
 Worm   151 PE----SYYKLFWKTRLALLYIYKYVSKDFDWYFKGDDDTYLIVENLQRYLATLDPNKPYFIGYR 211

  Fly   174 MS-RYNVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDST 237
            :| |....|.:||:.|::||||:..||.:.:..:..||..:   .||:.:..|:.:||:..:||.
 Worm   212 LSRRTETGYNAGGSGYVMSREAMRIFAEKLFNDKQKCPYHE---WEDYAIAQCLASVGIVPLDSR 273

  Fly   238 HALDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVET-GLACCSNYSVAFHYASRERMFLY 301
               |...:.:|:|...|.:.. |:.|     |...:..::. |.|......::.|:...:.:.|.
 Worm   274 ---DEKGRQRFLPWRPEQHFY-ADLT-----RSFQMDPIQVWGPAIYHENLISMHHLHPDEIRLI 329

  Fly   302 EFLIYHLKVFDPNQISERGHRSRLTLSDLTRRFPLEDNSN 341
            :.|:|.:         .||         :.|:..|||..|
 Worm   330 DGLLYSI---------ARG---------IWRQDDLEDVRN 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 53/157 (34%)
bus-4NP_500615.2 Galactosyl_T 104..>235 CDD:304462 48/135 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88678690
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.