DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and E03H4.3

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_493146.2 Gene:E03H4.3 WormBaseID:WBGene00008471 Length:322 Species:Caenorhabditis elegans

Alignment Length:275 Identity:81/276 (29%)
Similarity:121/276 (44%) Gaps:36/276 (13%)


  Fly    49 TATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPT- 112
            :|:|.|:.:.  .:|.|.|.|..........|:..||.:||....|.|.   .||....:...| 
 Worm    68 SASTLRLPNS--GQIFCFVETSERYYNDRVPSIAATWLRRCDNGRFFSK---TPLPSANMTYSTV 127

  Fly   113 ----GGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYK 173
                ...:.||:.|:..||.:.:.|.:..:||:||||||||..|::|:..|...||:.|::.||.
 Worm   128 YKNLEDSFFDLFRKSIFGFYYSYMHISNSFDWYLKADDDTYFAMDHLREYLNTLDPSKPLYLGYV 192

  Fly   174 M-SRYNVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDST 237
            : |.....|.||||.||||..|:..|..:.|..|..||..   ..||..||.|:..||::..|:.
 Worm   193 IKSGLKNGYNSGGAGYILSNAAVKIFVEKLYHDEYGCPYD---WAEDRGMGRCLARVGIYPTDTR 254

  Fly   238 HALDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYE 302
               |.....:|||                 .|....:.||.|......: |:.|...::.|.|.:
 Worm   255 ---DDKGFNRFMP-----------------YRPSEQAAVEAGQFSSQKF-VSLHRFPQDTMLLLD 298

  Fly   303 FLIY-HLKVFDPNQI 316
            .|:: .|:..|.|.:
 Worm   299 ELLHPELRKNDTNPV 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 54/155 (35%)
E03H4.3NP_493146.2 Galactosyl_T <130..252 CDD:304462 47/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88701636
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.