DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and C17A2.3

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans

Alignment Length:211 Identity:64/212 (30%)
Similarity:101/212 (48%) Gaps:17/212 (8%)


  Fly    43 STSTMTTATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRC--SRLIFASSEDYEPLGV 105
            |.:|.|..|:.        :|.|.|.|..:..:....||..||..||  .|....:...|..:..
 Worm    90 SPATFTLPTSG--------QIFCFVETSTKYYKDRVPSVASTWLPRCDHGRFFTKTHLPYPDIAY 146

  Fly   106 VGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFF 170
            ..|.......|:||:.|:.....:.:...:..:||:||.||||:|.|::|:..|...:|..|::.
 Worm   147 STVYRNLRDTYDDLFRKSIFSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLNTLNPAEPLYL 211

  Fly   171 GYKMSRY-NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFV 234
            ||:::.: |..|.|||:.||||..|:..|..|.|.:..:||..:.   ||..||.|:::||:...
 Worm   212 GYRLAPFMNNGYNSGGSGYILSNAAMRMFVEQLYHNVRLCPYDRG---EDRGMGRCLESVGITPS 273

  Fly   235 DSTHALDGDTKPKFMP 250
            |:.   |.....:|||
 Worm   274 DTR---DDQELNRFMP 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 47/152 (31%)
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 44/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88701611
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.