DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and C16D9.6

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_505126.2 Gene:C16D9.6 WormBaseID:WBGene00015861 Length:340 Species:Caenorhabditis elegans

Alignment Length:338 Identity:89/339 (26%)
Similarity:149/339 (44%) Gaps:92/339 (27%)


  Fly    17 FMAGFVLAFVLLLYV-------------------------YDVSRVTP------------CWSST 44
            |::...|||::|..:                         .|:..|:|            ||..|
 Worm    40 FISTIALAFLILAAILITIFLLTRNNSPRATYDRKNDSKLLDLIEVSPAAQRLPKKGKLFCWVQT 104

  Fly    45 STMTTATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYE----PLGV 105
            ||:.                       .:.:|||  :.|||..||......:||.:.    |...
 Worm   105 STIY-----------------------HDTRSLA--INETWIHRCDHGQLFTSERFNDTRIPYST 144

  Fly   106 V--GVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPV 168
            |  |:.:    .|.:|:.|:|..|.|::.:.:.::||:|||||||:|::|||:..|...:|:.|.
 Worm   145 VFKGIPD----DYYNLFFKSRYAFHHIYTNISSEFDWYLKADDDTFVIVENLRSFLSTLNPDEPH 205

  Fly   169 FFGYKMSRY-NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFY--MGI--CMQN 228
            :.||.:..| ...|.:|||.|||||.||..|:.|.|.:..:||       :|.|  :||  |:.|
 Worm   206 YLGYVLKPYLKNGYNAGGAGYILSRAALKIFSEQLYSNATLCP-------DDIYEDVGIARCLAN 263

  Fly   229 VGVHFVDSTHALDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYA 293
            .|::..|:.::|..:....|.|.| ..:.:.|..   :|::.    :...|....:|..::||..
 Worm   264 AGMYPEDTRNSLGQNRFNTFSPSD-TFHQTKAGI---DWVKF----KENKGYEAFANDLISFHKL 320

  Fly   294 SRERMFLYEFLIY 306
            |.:.:.|::.|:|
 Worm   321 SPDEIRLFDILLY 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 55/160 (34%)
C16D9.6NP_505126.2 Galactosyl_T 98..>250 CDD:304462 59/188 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88678655
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.