DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and C02H6.1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans

Alignment Length:322 Identity:82/323 (25%)
Similarity:131/323 (41%) Gaps:45/323 (14%)


  Fly    22 VLAFVLLLYVYDVSR--VTPC---------------WSSTSTMTTATTARIEDGPPP-------R 62
            :|.|.|.|.|:.:.|  :.|.               :.|.:......|..|||....       :
 Worm    22 LLTFSLSLIVFPLYRNFLIPADLYTHFPAIIHPYREYYSLTRNVNKLTQGIEDSEATYDLPTSGQ 86

  Fly    63 ILCMVLTCPENVQSLARSVYETWGQRC--SRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTRE 125
            :.|.|.|..:.......|:..||..||  .|....:....|.:....|.......|.||:.||..
 Worm    87 LFCFVETSKKYFNDRVPSMASTWLPRCDNGRFFLKTPLVDEKIPFSTVYRNLEDSYYDLFRKTLL 151

  Fly   126 GFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSGGASYI 189
            .|.:.:.:.:.|:||:||||||.|.::::|:..|...|.:.|:|.||:|..: ...|.||||.|:
 Worm   152 SFYYSYTYISKDFDWYLKADDDNYFMIDHLKEYLDTLDASKPLFLGYRMKPFLEGGYNSGGAGYL 216

  Fly   190 LSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLE 254
            ||..|:..|....|..|..||..   ..||..:..|:.::|:...|:.   |.|...:|:|    
 Worm   217 LSNAAVRIFVEHLYHDEKRCPYD---WAEDRGIARCLASMGILPSDTR---DNDGSCRFLP---- 271

  Fly   255 NYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIY---HLKVFDP 313
             :.......|||......|   :.| :..|...::.|..|..:|...:.::|   ..::|.|
 Worm   272 -FRPSEMPGIPEAYHYYPL---KNG-SFVSEKFISLHRISPRKMIFLDSILYPSSERRLFTP 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 47/152 (31%)
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 44/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88701620
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.