DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and ZC250.2

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_504520.2 Gene:ZC250.2 WormBaseID:WBGene00022576 Length:449 Species:Caenorhabditis elegans

Alignment Length:364 Identity:73/365 (20%)
Similarity:124/365 (34%) Gaps:114/365 (31%)


  Fly    17 FMAGFVLA--------------------------FVLLLYVYDVSR-------------VTPCWS 42
            |.|||:|:                          |...|:.::..|             :..|..
 Worm   145 FSAGFILSKSVVEIIRKVDINDRWSGFAIDAKYEFAQFLHKWENLRLHHHPDYFCCGDTIDSCIV 209

  Fly    43 STSTMTTATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVG 107
            ..|.....|:..|.|.   .:..||.|...:..:....:..||....||:.:.|.::...:..:.
 Worm   210 KCSIPFPKTSNSISDS---EVHVMVKTFEGHHVNRLEVLKNTWASDVSRIEYCSDKEDPAIPTIN 271

  Fly   108 V-VEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVF-- 169
            : |:.|..|:   ..||.|.||...........|.:.|||||.:..:.|:.:|..:|....:.  
 Worm   272 LGVDNTDRGH---CAKTWEIFRRFLGSSGNGAKWLVVADDDTLMNFKRLKQMLELYDSGDKIIIG 333

  Fly   170 --FGYKMSRYNVS---YMSGGASYILSREALHRFATQAYESEVICP------QPKKMGIEDFYMG 223
              :||..|....|   |.:||:..|.:|.|:.....|       ||      .|     :|..:|
 Worm   334 ERYGYGFSLNGDSGYDYPTGGSGMIFTRSAVESLLAQ-------CPSCIANTDP-----DDMTIG 386

  Fly   224 ICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSV 288
            ||....|:..|..:..      .:..|||.          .||:::                |.:
 Worm   387 ICALTAGIPIVHESRL------HQARPLDY----------APEYIK----------------YPI 419

  Fly   289 AFH-YASRERMFL-YEFLIYHLKVFDPNQISERGHRSRL 325
            :|| :...:.:.: ||:|:         ::.|..|:|.|
 Worm   420 SFHKFTDIDPISVYYEYLV---------ELEEYNHKSEL 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 40/163 (25%)
ZC250.2NP_504520.2 Galactosyl_T 231..424 CDD:304462 52/240 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.