DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and Y38C1AB.1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499857.3 Gene:Y38C1AB.1 WormBaseID:WBGene00021403 Length:261 Species:Caenorhabditis elegans

Alignment Length:260 Identity:65/261 (25%)
Similarity:116/261 (44%) Gaps:27/261 (10%)


  Fly    58 GPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNK 122
            |.|..|||::.|...:.::.|:::.|||.|.|...:|.:...... .:..:..|.....:..|.|
 Worm    17 GAPQTILCLIHTATPSHETRAKTILETWVQHCDDFLFFTDSKMND-SIPHIYYPLLNSRDHSWEK 80

  Fly   123 TREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGAS 187
            .|..|::|.:.....|||:.:||||||.:|.|::.||..:.|....:.|.:.:.:.....:.|:|
 Worm    81 IRRVFKYVRDKITKKYDWYYRADDDTYALMHNMRTLLDNYSPTKHHYLGLQWNFFTPRGFNDGSS 145

  Fly   188 YILSREALHRFATQAYESEVI-----CPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPK 247
            |||||..:..|      :||:     ||...: ..||..:..|:.::.::..|....:..:....
 Worm   146 YILSRPTMEAF------NEVMLDPDRCPDHHR-AEEDQELAKCLAHMEIYPEDIRDEMGSERIQH 203

  Fly   248 FMPLD-LENYMSDANYTIPEWLRLMSLSRVETGLACCSNYS---VAFHYASRERMFLYEFLIYHL 308
            |.||: |..|....|..:..:..:..          ..|:|   ::||:.|...|.|.:::.|.|
 Worm   204 FHPLEQLTIYKDTFNRRLAYYPAMKE----------DENFSDKMISFHHVSPYEMRLMDYIFYRL 258

  Fly   309  308
             Worm   259  258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 39/154 (25%)
Y38C1AB.1NP_499857.3 Galactosyl_T 33..>129 CDD:304462 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88678769
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.