DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and W09D10.5

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499361.3 Gene:W09D10.5 WormBaseID:WBGene00012363 Length:321 Species:Caenorhabditis elegans

Alignment Length:366 Identity:77/367 (21%)
Similarity:140/367 (38%) Gaps:125/367 (34%)


  Fly     4 KMKLRSQ----LHLLTGFMAGFVLAFVLLLYVY----DVSR-VTPCWSSTSTMTTATTARIEDGP 59
            |.::||.    :||..|...|:::.   :|:::    |:|: :.......||            |
 Worm     8 KSRIRSPRDVVIHLALGVSLGYLIG---ILFIFDGDNDISKHIHLMEHEKST------------P 57

  Fly    60 PP---RILCMVLT-----CPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGY 116
            .|   .:.|:::.     .|||:.|   ::.:.:.:.|...||.::.                  
 Worm    58 KPESFNLRCVIILHKATHKPENIIS---AITDGYAKLCQETIFFTNN------------------ 101

  Fly   117 EDLWNKTREGFR------HV--------WEH--YAGDY------DWFLKADDDTYVVMENLQHLL 159
            :.|::|.:: |:      ||        |.:  ||.::      .|....||.||:::.||::.|
 Worm   102 QKLFDKFQK-FQNNYTMYHVDSSLNHFYWTYYLYAMEFSSKVPAQWTFLGDDQTYLIVPNLRNTL 165

  Fly   160 RGFDPNTPVFFG------------YKMSRYNVSYMSGGASYILSREALHR-------FATQAYES 205
            |.||...||..|            :.:|.:....:.||.  :||..|:.:       |.::|   
 Worm   166 RNFDSEKPVVLGKVKDTSTLFSWLFPLSSFKKISVRGGV--VLSNPAIDKLSACKGFFFSRA--- 225

  Fly   206 EVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDANYTIPEWLRL 270
                        .||.:..|.:..||...|   ..|.|.      |.|.|.:.......|: .:|
 Worm   226 ------------SDFALYDCSEKYGVQIAD---PFDEDA------LRLFNDLPPKQIIAPD-SKL 268

  Fly   271 MSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVF 311
            ...|..:.|.  ||:::::|...|.:.|.:.:|.: .||||
 Worm   269 FRSSPTKAGK--CSDHAISFGQLSEKDMRVLQFGM-SLKVF 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 38/190 (20%)
W09D10.5NP_499361.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.