DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and C38H2.2

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499293.2 Gene:C38H2.2 / 176455 WormBaseID:WBGene00008019 Length:389 Species:Caenorhabditis elegans


Alignment Length:251 Identity:102/251 - (40%)
Similarity:146/251 - (58%) Gaps:7/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            |:.|.:||..:|....|:.|..||.:||::.:|.|||:...|..:.:....|..|  ||.||:..
 Worm   105 RVFCWILTGKQNHDKRAKHVKATWAKRCNKYVFMSSEEDAELPAINLNVSEGRDY--LWAKTKGA 167

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNV-SYMSGGASYIL 190
            |:::::|:..|||||||||||||||||||:.:|....|:.|:.||.|...:.. .|.||||.|:|
 Worm   168 FKYIYDHHLNDYDWFLKADDDTYVVMENLRFMLLAHSPDEPIHFGCKFKPFTQGGYHSGGAGYVL 232

  Fly   191 SREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLEN 255
            |||||.:|...|...:.:|.| ...|.||..||.|::.|||...||.   |.|...:|||...|:
 Worm   233 SREALKKFIEVALPDKSLCSQ-NHGGAEDAEMGKCLEKVGVKAGDSR---DADGHHRFMPFVPEH 293

  Fly   256 YMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVF 311
            ::|..:.....|....:...::.|..|||:|:|:|||.:...|::.|:||||||.|
 Worm   294 HLSPGHVDPKFWFWQYTYYPMDQGPTCCSDYAVSFHYVNPNLMYVLEYLIYHLKPF 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 65/149 (44%)
C38H2.2NP_499293.2 Galactosyl_T 106..>274 CDD:304462 73/170 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.