DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and c1galt1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002938761.1 Gene:c1galt1 XenbaseID:XB-GENE-992000 Length:362 Species:Xenopus tropicalis

Alignment Length:372 Identity:116/373 (31%)
Similarity:179/373 (48%) Gaps:54/373 (14%)


  Fly     8 RSQLHLLT---GFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDGP--PP------ 61
            :|.|.|.|   |...||:.::|:...|:: .:.:|................:|.|  ||      
 Frog     5 KSVLSLATFSFGIAIGFIFSYVIFSIVFE-GQDSPQGKPEVLHNDPHGRHSDDAPAGPPLQGQMD 68

  Fly    62 -----------------------RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPL 103
                                   :|||.|:|.|:|:....:.|..||.|||:::::.|||:.:..
 Frog    69 FNADAQQHHDEDTHVADDLYSKVKILCWVMTGPQNLDKKTKHVKATWAQRCNKVLYMSSEENKEF 133

  Fly   104 GVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPV 168
            ..||:  .|..|.:.|:.||.:.|::|.:|:..:.|||:|||||||||::||:.||...|||.||
 Frog   134 PTVGL--DTKEGRDQLYWKTIKAFQYVHDHHLEEADWFMKADDDTYVVLDNLRWLLSKHDPNDPV 196

  Fly   169 FFGYKMSRY-NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVH 232
            :||.:...| ...||||||.|:||:|||.|| ..|::.|. |..  ...:||..:|.||:|:.|.
 Frog   197 YFGRRFKPYVKQGYMSGGAGYVLSKEALKRF-VNAFKEEK-CTH--SSSVEDLALGKCMENINVK 257

  Fly   233 FVDSTHALDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRER 297
            ..||.   |...|..|.|...|:::.........|....:......|..|||:.:|:|||.....
 Frog   258 AGDSR---DTSGKETFHPFVPEHHLIHGYLPKTFWYWNYNYYPAVEGPGCCSDLAVSFHYVDSTT 319

  Fly   298 MFLYEFLIYHLKVFDPNQISERGHRSRLTLSDLTRRFPLEDNSNIKD 344
            |:..|:|::||:.:        |::.|.: .|.|.:...:|....||
 Frog   320 MYQLEYLVHHLRPY--------GYKHRYS-PDSTAKTMKDDTDKTKD 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 64/150 (43%)
c1galt1XP_002938761.1 Galactosyl_T <168..>254 CDD:304462 46/90 (51%)
EEP 280..>361 CDD:294334 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.