DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and LOC100486323

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_017947371.1 Gene:LOC100486323 ID: Length:254 Species:Xenopus tropicalis

Alignment Length:250 Identity:91/250 (36%)
Similarity:137/250 (55%) Gaps:21/250 (8%)


  Fly    68 LTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREGFRHVWE 132
            :|.|.|:||.|..:..:|.:.|:..:|.||...|....:|:  .|..|.|:|:.||...|:::.:
 Frog     1 MTSPNNLQSKAIHLKRSWTRHCNITLFMSSTANETFPTIGL--GTKEGREELYWKTIRAFQYIHQ 63

  Fly   133 HYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSGGASYILSREALH 196
            :|....||||||||||:|||||||.||..:.|..|::.|.:...: |..||||||.|:||:|:|.
 Frog    64 NYLDQADWFLKADDDTFVVMENLQFLLSNYTPEQPIYLGKRFKPFVNQGYMSGGAGYVLSKESLK 128

  Fly   197 RFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLE-----NY 256
            || .:|:.:.| |....  .|||..:|.||:.:||...||.   |.:.:..|.|...|     .|
 Frog   129 RF-VEAFRTGV-CTHTS--SIEDLALGQCMEKLGVIPGDSR---DSEKRETFHPFTPETHIITRY 186

  Fly   257 MSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVF 311
            .:|:.|....:..|:.      |..|||:.:::|||...|.|:..|:.:|||:.:
 Frog   187 TADSIYWGYCYYPLIQ------GPQCCSDLAISFHYVPPELMYTLEYFVYHLRAY 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 61/150 (41%)
LOC100486323XP_017947371.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.