DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and LOC100486174

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002933748.2 Gene:LOC100486174 ID: Length:335 Species:Xenopus tropicalis

Alignment Length:334 Identity:103/335 (31%)
Similarity:166/335 (50%) Gaps:47/335 (14%)


  Fly     1 MTAKMKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVT-------PC-WSSTSTMTTATTARIED 57
            :|..:...|.|:...|.:.||   |:.|.....|..:|       |. |.:...:..:..:.:.:
 Frog     5 LTKNVPCSSCLYFCLGLLVGF---FMTLNMYNSVQELTISFNPPDPSQWDNNHFIHLSDNSNVSE 66

  Fly    58 --GPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLW 120
              ....|:||.::|.|:|::..|..:..:|.:.|:..:|.||...|....:|:  .|..|.|:|:
 Frog    67 LLARKVRVLCWIMTSPKNLKKKAIHLKRSWARHCNITLFMSSTANEIFPTIGL--GTKEGREELY 129

  Fly   121 NKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSG 184
            .||...|:::.::|....||||||||||||||||||.||..:.|..|::.|.:...: ...||||
 Frog   130 WKTIRAFQYIHQNYLDQADWFLKADDDTYVVMENLQFLLSNYTPEQPIYLGKRFKPFVTQGYMSG 194

  Fly   185 GASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFM 249
            ||.|:||:|:|.|| .:|:.:.| |....  .|||..:|.||:.:||...||.   |.:.:..|.
 Frog   195 GAGYVLSKESLKRF-VEAFRTGV-CTHTS--SIEDLALGQCMEKLGVIPGDSR---DSEKRETFH 252

  Fly   250 PL------------DLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYE 302
            |.            |.::|.:...|.|.:            |..|||:.:::|||.|.|.|::.|
 Frog   253 PFTPETHITSDYINDFDDYWTYCYYPIIQ------------GPQCCSDLAISFHYVSPELMYMLE 305

  Fly   303 FLIYHLKVF 311
            :.:|:|:.:
 Frog   306 YFVYYLRAY 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 61/150 (41%)
LOC100486174XP_002933748.2 Galactosyl_T 92..>237 CDD:304462 61/151 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.