DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and LOC100486030

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002933747.2 Gene:LOC100486030 ID: Length:276 Species:Xenopus tropicalis

Alignment Length:280 Identity:90/281 (32%)
Similarity:145/281 (52%) Gaps:34/281 (12%)


  Fly    68 LTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREGFRHVWE 132
            :|.|.|:|:.|..|..||.:.|:..:|.||...:....:|:  .||.|.:.|:.||...|.:..:
 Frog     1 MTGPSNLQTKAIHVKNTWTRHCNVALFMSSVTDKEFPTIGL--GTGEGRDKLYWKTIRAFHYAHK 63

  Fly   133 HYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSR-YNVSYMSGGASYILSREALH 196
            :|..:.|||||||||||.:::||:.:|..:.|:.|::||.:... :...||||||.|:||||||.
 Frog    64 YYLNETDWFLKADDDTYAIVDNLRWMLSNYTPDQPIYFGKRFKPFFKQGYMSGGAGYVLSREALI 128

  Fly   197 RFATQAYESEV---ICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMS 258
            || .:.:.:.:   |.|      .||..||.|||.:||...||.   |.:.:..|.|...|:.::
 Frog   129 RF-VEGFRTGICRHITP------TEDVAMGNCMQLMGVIAGDSR---DTEKRETFNPFAPESQLT 183

  Fly   259 DANYT--IPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISERGH 321
             ..|:  ...|..:.....:..|..|||:.::::||.|.|.|:..|:..||.:.:        |:
 Frog   184 -VKYSEHKENWYWVYCFYPIVEGPQCCSDLAISYHYISPELMYTLEYFTYHFRPY--------GY 239

  Fly   322 RSRLTLSDLTRRFPLEDNSN 341
            :.|.       :.||.:|::
 Frog   240 QYRY-------QPPLPENAH 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 57/153 (37%)
LOC100486030XP_002933747.2 Galactosyl_T 9..>159 CDD:304462 60/159 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.