DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and LOC100485879

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002933746.2 Gene:LOC100485879 ID: Length:350 Species:Xenopus tropicalis

Alignment Length:350 Identity:105/350 (30%)
Similarity:172/350 (49%) Gaps:46/350 (13%)


  Fly    11 LHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTS--------------TMTTATTARIEDGPPP 61
            |.|..|...||.:|:.::...:::....|....:|              .:...|:|..|.....
 Frog     4 LPLTLGASIGFFIAYFMVHTFWELKPHLPLAIRSSHNSEHMPADGISHFHLPEDTSASEELYSKV 68

  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            |:||.::|.|.|:|:.|..|..||.:.|:..:|.||...:....:|:  .||.|.:.|:.||...
 Frog    69 RVLCWIMTGPSNLQTKAIHVKNTWTRHCNVALFMSSVTDKEFPTIGL--GTGEGRDKLYWKTIRA 131

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSR-YNVSYMSGGASYIL 190
            |.:..::|..:.|||||||||:|.:::||:.:|..:.|:.|::||.:... :...||||||.|:|
 Frog   132 FHYAHKYYLNETDWFLKADDDSYAIVDNLRWMLSNYTPDQPIYFGKRFKPFFKQGYMSGGAGYVL 196

  Fly   191 SREALHRFATQAYESEVICPQ--PKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDL 253
            |||||.|| .:.:.:. ||..  ||    ||..||.|||.:||...||.   |.:.:..|.|...
 Frog   197 SREALIRF-VEGFRTG-ICTHTTPK----EDVAMGNCMQLMGVTAGDSR---DTEKRETFNPFSP 252

  Fly   254 ENYMSDANYT--IPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQI 316
            |:::: ..|:  ...|....|...:..|..|||:.::::||...|.|:..|:..||.:.:     
 Frog   253 ESHLT-VKYSEHKENWYWSYSFYPIVEGPQCCSDLAISYHYIYPELMYTLEYFTYHFRPY----- 311

  Fly   317 SERGHRSRLTLSDLTRRFPLEDNSN 341
               |::.|.       :.||.:|::
 Frog   312 ---GYQYRY-------QPPLPENAH 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 58/152 (38%)
LOC100485879XP_002933746.2 Galactosyl_T 83..>233 CDD:304462 61/158 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.