DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3123 and CG7120

Sequence 1:NP_608716.1 Gene:CG3123 FlyBaseID:FBgn0031465 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster

Alignment Length:699 Identity:176/700 (25%)
Similarity:297/700 (42%) Gaps:108/700 (15%)


  Fly     1 MKRKRVASRLFNIFLLAVLCYLILTSL------------SDRNKTI----SIREVPQIYINEEDE 49
            :.||.|...|.:.    ..||.::...            ||...|:    ::.:|....|.|.:.
  Fly    40 VSRKSVLGLLVSF----TFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTVMDVEPEPITETNP 100

  Fly    50 -----LFVNTTGCRISATKPLSLYALSFMEPIEPVLC-RMEQL-MVAETIGDRNYLV----RNIS 103
                 ..|.:..|||....|.....:...:.|:...| ::..| .|......:.||:    ....
  Fly   101 SVPKGFLVYSNSCRIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKFEAKSQKYLLSIDGAAFG 165

  Fly   104 RHGILSWRQVSCIYREFVRVDDAHNKYISLKFFK----LTDRTR--YLEVGTGLQHIRTWCWVDF 162
            |:.:  .:|:.|.|....|||:...||...:.||    |.|...  .::..:|            
  Fly   166 RYPV--GKQLHCCYMSVQRVDEMKVKYTKCQTFKGSILLPDSAEGIIVKCDSG------------ 216

  Fly   163 GRIIFHDVMYFLP-------PLPQATNRSTEHQKRKLSVMILGVDSISHMHYMRYFHRVADFIEH 220
            ||.|:.:....:|       .|..|:....:..:|..||::||:||||.::.:|...:.|.::..
  Fly   217 GRQIYINGHATVPVKEAVQQRLRMASEADAKGYQRPPSVLMLGIDSISRVNLIRAMPKTAQYLYD 281

  Fly   221 LPHTEFWGYNRVALNTYPNLIPLVSGLSVSEMEASCYHDEL-NFDKCNFLWNEFKRAGYSTIFAE 284
            ....|..|||:|..||:||::.:::|.::.....:|....: ..|||:::|.::::.||.|.:||
  Fly   282 NGWFELAGYNKVDDNTFPNIMAVLTGYNLPNAMHACSPFVVGGLDKCDYIWKQYQQRGYVTAYAE 346

  Fly   285 DTDTAGLFIYRKRGFQKQPTDIYMRPLMTEIESHSLYRTTFD--LKCTGHRLYGEFYYDFVSKLI 347
            |......|.|.|:||:..|.|.|:||.::..|| .|..||.:  :.|.|:....|..||:..:..
  Fly   347 DAVKINTFNYLKKGFKNPPADYYLRPYLSAAES-QLDHTTVNGLVHCLGYLTAAEHVYDYGLEFT 410

  Fly   348 PHMERQLFFSFLW-NMHGIHDVFPYAKFVDKDYLSILTRLHEKGVMENTLILFMGDHGLRFDKFA 411
            .....:.:|.|.| |.|. |........:|......|.:|..:|.||||:::|..|||:||....
  Fly   411 RRFLNETYFGFFWTNTHS-HSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDHGMRFGPTR 474

  Fly   412 RTAPGQHEMSQPLLIAIYPEWLKRRFPLAMSNFERNARSLITTFDLHETLKDVI------HLDRL 470
            .|..|..|...|.:....|:.|:|..|..:.:.:.|...|.|.:|||.|:|.::      .::.|
  Fly   475 ATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISGRAEMESL 539

  Fly   471 TDANVRNRTLYLTNERGISLFLPIPQNRNCKTAEIKQHYCLCNELKSVSTHESAIQEAASFAVDR 535
            ..|.        ...:..||..|:...|:|....|..|:|.|.|..::|:.....:......|..
  Fly   540 GPAP--------DCPQCQSLLTPVSPQRSCSDVGIADHWCTCWEYDTISSTSKESRMLGKRVVSY 596

  Fly   536 INELIKPYPQ------CRVLSLQSVRTAYRAKSS--------TYRGNYRVSQVMVRLKTTPGDGN 586
            :|..:..:..      |..|||.|:::|:||..:        |||         :...|:|..|.
  Fly   597 LNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHNALDPDEVHTYR---------LIFVTSPNKGQ 652

  Fly   587 FDATVLITMLNGEKTD--MKLGGPVTRTDRYAHQAYCVQNYRIEMYCYC 633
            ::||     |....||  :|:.|.|:|.:.|:.:|.|:.::..:.||||
  Fly   653 YEAT-----LRHNHTDDSVKVTGSVSRLNVYSGEADCMNDFAAKKYCYC 696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3123NP_608716.1 DUF229 74..555 CDD:281053 134/516 (26%)
ALP_like 192..468 CDD:293745 87/286 (30%)
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 134/516 (26%)
ALP_like 253..528 CDD:293745 87/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49376
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.