DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2862 and HIT3

Sequence 1:NP_001259964.1 Gene:CG2862 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_567038.1 Gene:HIT3 AraportID:AT3G56490 Length:147 Species:Arabidopsis thaliana

Alignment Length:139 Identity:71/140 (51%)
Similarity:92/140 (66%) Gaps:3/140 (2%)


  Fly    15 SRQIASCSARMASEVEKSQTAAASED-TIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLV 78
            |...:..||.||||.|.:..|..|:. |||.||:.||||...:.||||.:||.|:.||.|.|.|:
plant     9 SSHFSPASAVMASEKEAALAATPSDSPTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILL 73

  Fly    79 IP--RKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLG 141
            ||  |..:..||.||:...|:||.|:...:.|||:.|||:|:|:|||:|..|.|||||:|:|.:|
plant    74 IPKVRDGLTGLSKAEERHIDILGRLLYTAKLVAKQEGLAEGFRIVINDGPQGCQSVYHIHVHLIG 138

  Fly   142 GRQMQWPPG 150
            ||||.||||
plant   139 GRQMNWPPG 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2862NP_001259964.1 PKCI_related 40..142 CDD:238607 53/105 (50%)
HIT3NP_567038.1 PKCI_related 35..139 CDD:238607 53/104 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H3904
Inparanoid 1 1.050 141 1.000 Inparanoid score I1735
OMA 1 1.010
OrthoDB 1 1.010 D1190598at2759
OrthoInspector 1 1.000 T125382
orthoMCL 1 0.900 OOG5_126794
Panther 1 1.100 O PTHR23089
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.