DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2862 and hint2

Sequence 1:NP_001259964.1 Gene:CG2862 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001077041.1 Gene:hint2 ZFINID:ZDB-GENE-070410-139 Length:161 Species:Danio rerio

Alignment Length:152 Identity:85/153 (56%)
Similarity:110/153 (72%) Gaps:7/153 (5%)


  Fly     3 LSTGRNFFRVFSSRQIASCSARMASEVEKSQTAAAS----EDTIFGKILRKEIPCKFIHEDDKCV 63
            |..||..:||.|   :.||.:.:..||..:|.|:..    |.|||.||:.|.:|...|:|||||:
Zfish    13 LPFGRGLWRVLS---VKSCYSTINDEVRLAQEASKKYGKLEPTIFTKIIDKTVPAVIIYEDDKCL 74

  Fly    64 AFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHG 128
            ||.||.||||.|:|||||.||.::|.|.|.|:.:||||::|.:.:||:.|||:|||||||:||:|
Zfish    75 AFRDVNPQAPVHYLVIPRIPIPRISEAHDEDSLILGHLLVVAKNIAKKEGLAEGYRVVINDGKNG 139

  Fly   129 AQSVYHLHLHFLGGRQMQWPPG 150
            ||||||||:|.||||||:||||
Zfish   140 AQSVYHLHIHVLGGRQMKWPPG 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2862NP_001259964.1 PKCI_related 40..142 CDD:238607 64/102 (63%)
hint2NP_001077041.1 PKCI_related 51..153 CDD:238607 64/102 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188072213
eggNOG 1 0.900 E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1190598at2759
OrthoFinder 1 1.000 FOG0001758
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126794
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.