DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and Hint1

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001103077.1 Gene:Hint1 / 690660 RGDID:1593411 Length:126 Species:Rattus norvegicus

Alignment Length:126 Identity:84/126 - (66%)
Similarity:102/126 - (80%) Gaps:0/126 - (0%)


  Fly    25 MASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSL 89
            ||.|:.|:|.|....|||||||:|||||.|.|.|||:|:||||::|||||||||||:|.|:|:|:
  Rat     1 MADEIAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISV 65

  Fly    90 AEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 150
            |:|.|..||||||:||:|.|.:|||..|||:|:|.|..|.|||||:|||.||||||.||||
  Rat    66 ADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 69/101 (68%)
Hint1NP_001103077.1 PKCI_related 16..118 CDD:238607 69/101 (68%)
Histidine triad motif 110..114 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4335
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3904
Inparanoid 1 1.050 187 1.000 Inparanoid score I3823
OMA 1 1.010 - - QHG60959
OrthoDB 1 1.010 - - D1190598at2759
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 1 1.000 - - otm45965
orthoMCL 1 0.900 - - OOG6_100377
Panther 1 1.100 - - LDO PTHR23089
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1204
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.