DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2862 and hint1

Sequence 1:NP_001259964.1 Gene:CG2862 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001016165.1 Gene:hint1 XenbaseID:XB-GENE-1014427 Length:126 Species:Xenopus tropicalis

Alignment Length:126 Identity:81/127 (64%)
Similarity:97/127 (76%) Gaps:0/127 (0%)


  Fly    25 MASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSL 89
            ||.|:.|:|||....|||||||:|||||.|.|:||::|:||||:|||||.||||:|:|.|..||.
 Frog     1 MADEISKAQTACPGGDTIFGKIIRKEIPAKIIYEDEQCIAFHDIAPQAPVHFLVVPKKFITHLSK 65

  Fly    90 AEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 150
            |:..|..||||||:||.|.|.:|||.:|||:.:|.|..|.|||||||||..|||||.||||
 Frog    66 ADPADEKLLGHLMIVGSKCAADLGLTNGYRLAVNEGPDGGQSVYHLHLHVFGGRQMGWPPG 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2862NP_001259964.1 PKCI_related 40..142 CDD:238607 66/102 (65%)
hint1NP_001016165.1 PKCI_related 16..118 CDD:238607 66/102 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0537
Hieranoid 1 1.000
Homologene 1 1.000 H3904
Inparanoid 1 1.050 180 1.000 Inparanoid score I3798
OMA 1 1.010
OrthoDB 1 1.010 D1190598at2759
OrthoFinder 1 1.000 FOG0001758
OrthoInspector 1 1.000 T1059417
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2151
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.