DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2862 and HINT1

Sequence 1:NP_001259964.1 Gene:CG2862 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_005331.1 Gene:HINT1 HGNCID:4912 Length:126 Species:Homo sapiens

Alignment Length:126 Identity:85/127 (67%)
Similarity:102/127 (80%) Gaps:0/127 (0%)


  Fly    25 MASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSL 89
            ||.|:.|:|.|....|||||||:|||||.|.|.|||:|:||||::|||||||||||:|.|:|:|:
Human     1 MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISV 65

  Fly    90 AEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 150
            |||.|..||||||:||:|.|.:|||..|||:|:|.|..|.|||||:|||.||||||.||||
Human    66 AEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2862NP_001259964.1 PKCI_related 40..142 CDD:238607 71/102 (70%)
HINT1NP_005331.1 PKCI_related 16..118 CDD:238607 71/102 (70%)
Histidine triad motif 110..114 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0537
Hieranoid 1 1.000
Homologene 1 1.000 H3904
Inparanoid 1 1.050 188 1.000 Inparanoid score I3862
Isobase 1 0.950 0.861654 Normalized mean entropy S1022
OMA 1 1.010
OrthoDB 1 1.010 D1190598at2759
OrthoFinder 1 1.000 FOG0001758
OrthoInspector 1 1.000 T1073324
orthoMCL 1 0.900 OOG5_126794
Panther 1 1.100 LDO PTHR23089
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2151
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.