DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2862 and HINT3

Sequence 1:NP_001259964.1 Gene:CG2862 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_974907.1 Gene:HINT3 AraportID:AT5G48545 Length:197 Species:Arabidopsis thaliana

Alignment Length:127 Identity:35/128 (27%)
Similarity:67/128 (52%) Gaps:7/128 (5%)


  Fly    17 QIASCSARMASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPR 81
            :::.||:..:.: .|.:::....|.:|.||:|.|.||..::|||.|:...|..|.:..|.|:||:
plant    27 RVSDCSSGSSGD-GKVESSTLQNDCVFCKIIRGESPCLKLYEDDMCLCILDTNPLSHGHSLIIPK 90

  Fly    82 KPIAQLSLAEDGD---ADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFL 140
              :...:|.|...   |.:...:.|:...:.|..| :|.:.:::|||....|.::|.|:|.:
plant    91 --LHYPTLEETPPSVVAAMCSKVPLISNAIVKATG-SDSFNLLVNNGAAAGQVIFHTHIHII 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2862NP_001259964.1 PKCI_related 40..142 CDD:238607 32/105 (30%)
HINT3NP_974907.1 HINT_subgroup 49..151 CDD:238608 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1190598at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126794
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.