DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10 and taf10

DIOPT Version :8

Sequence 1:NP_477463.1 Gene:Taf10 / 33469 FlyBaseID:FBgn0028398 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_595927.1 Gene:taf10 / 2540614 PomBaseID:SPBC21H7.02 Length:215 Species:Schizosaccharomyces pombe

Alignment Length:193 Identity:58/194 (30%)
Similarity:97/194 (50%) Gaps:30/194 (15%)


  Fly     4 DGEDISVTPAESVTSATDTEEEDIDSPL-MQSELH-SDEEQPDVE----------------EVPL 50
            ||.:......:..||:|:....|..:|: ::|..| ::|:.|..:                |:..
pombe    22 DGNNSMSVDEQPETSSTNLPTGDNLAPMSVESPAHLNNEDSPKSDDSRERHGSNYVIEPHLELRD 86

  Fly    51 TTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFISDIANDALQHC 115
            ..::..::..:.|::||||.|||.|..:.|..:||..|||::.:|:.::|||||||:|.||.|:.
pombe    87 MAKDKTLENFLAQMDDYSPLIPDVLLDYYLSLSGFKCVDPRLKKLLGLTAQKFISDVAQDAYQYS 151

  Fly   116 KTRTTNIQHSS-----------GHSSSKDKKNPKDR-KYTLAMEDLVPALADHGITMRKPQYF 166
            |.||.:...||           |.|.........|| |..|.::||..||.::||.:::|.:|
pombe   152 KIRTGSSNASSTTFGAQNFGAGGASGIGSSGRRGDRGKTVLTVDDLSAALNEYGINLKRPDFF 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf10NP_477463.1 TAF10 56..166 CDD:187739 45/122 (37%)
taf10NP_595927.1 COG5162 2..215 CDD:227491 58/194 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1749
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003315
OrthoInspector 1 1.000 T631642
orthoMCL 1 0.900 OOG5_129429
Panther 1 1.100 LDO PTHR21242
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2306
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.