DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and AT2G31440

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001325103.1 Gene:AT2G31440 AraportID:AT2G31440 Length:250 Species:Arabidopsis thaliana

Alignment Length:228 Identity:74/229 (32%)
Similarity:119/229 (52%) Gaps:13/229 (6%)


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLI-SSLWYALIPLKEFL-- 62
            ||:....|...:|.||..:|||..|:..|..|:.::::...||:||:| |.||...:|||..:  
plant     1 MTVAAGIGYALVALGPSLSLFVSVISRKPFLILTVLSSTLLWLVSLIILSGLWRPFLPLKANVWW 65

  Fly    63 --AFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTR-----VTDNKHILAYVSGLGFGIISG 120
              |..|:.||||||..|::.:::.:..|..|.:.|:...     :||...| |...|||.|:...
plant    66 PYALLVITSVCFQEGLRFLFWKVYKRLEDVLDSFADRISRPRLFLTDKLQI-ALAGGLGHGVAHA 129

  Fly   121 MFALVNVLADMSGPGTMGLKGGTEL-FFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVV 184
            :|..:::|....||.|..::..::: ||:.||..||:.:.:|||..||.|..:...|.:....|.
plant   130 VFFCLSLLTPAFGPATFYVERCSKVPFFLISAIIALAFVTIHTFSMVIAFEGYAKGNKVDQIIVP 194

  Fly   185 FSHLFVSLITLLN-ANELYTTTLLINYLVTILT 216
            ..||...::||:| |:|.....:.:.|||..||
plant   195 VIHLTAGMLTLVNFASEGCVIGVPLLYLVASLT 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 73/228 (32%)
AT2G31440NP_001325103.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9345
Inparanoid 1 1.050 108 1.000 Inparanoid score I2042
OMA 1 1.010
OrthoDB 1 1.010 D1085102at2759
OrthoInspector 1 1.000 T193512
orthoMCL 1 0.900 OOG5_130831
Panther 1 1.100 LDO PTHR12889
Phylome 1 0.910 0.800 Consistency score
98.980

Return to query results.
Submit another query.