DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and Aph1c

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_080950.1 Gene:Aph1c MGIID:1915568 Length:258 Species:Mus musculus

Alignment Length:248 Identity:112/249 (45%)
Similarity:161/249 (65%) Gaps:12/249 (5%)


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALIPL------- 58
            ||||.||||.||||||.|||::||||.||:|:|.|||.|||||:|||:||:::.|:.:       
Mouse     1 MTLPVFFGCAFIAFGPAFALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSMFWFLVRVITNNRDE 65

  Fly    59 ---KEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG 120
               ...|.||.:.|||.||.||...|::|:...:||.::..:..:..:..:|||||||||||:||
Mouse    66 SVQNYLLIFGALLSVCIQELFRLAYYKLLKKASEGLKSINPEEDIAPSMRLLAYVSGLGFGIMSG 130

  Fly   121 MFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVF 185
            :|:.||.|::..||||:|:.|.:..||:.||...|.:|:||.||.|:||:..:.|.:..:..|:.
Mouse   131 VFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDGCEKNKWYTLLTVLL 195

  Fly   186 SHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            :||.||..|.|  :..|...|:..|::.:|.|:.||.||||:.||.:..:.||
Mouse   196 THLVVSTQTFL--SPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKFCLLCQ 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 105/233 (45%)
Aph1cNP_080950.1 Aph-1 2..233 CDD:283708 105/233 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C290040911
eggNOG 1 0.900 E1_KOG3972
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3465
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1085102at2759
OrthoFinder 1 1.000 FOG0001574
OrthoInspector 1 1.000 T616801
orthoMCL 1 0.900 OOG5_130831
Panther 1 1.100 O PTHR12889
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.