DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and APH1A

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_024303223.1 Gene:APH1A HGNCID:29509 Length:316 Species:Homo sapiens

Alignment Length:294 Identity:114/295 (39%)
Similarity:163/295 (55%) Gaps:63/295 (21%)


  Fly     6 FFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISS-LWYALIPLKE--------- 60
            ||||||:||||.||||:.|:|.||:|:|||:|.|||||:|||::| :|:.|:.:.:         
Human     6 FFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYG 70

  Fly    61 FLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISGMFALV 125
            .|.||...||..||.||:..|::|:..::||.:::||.|...:...:||||||.||||||:|:::
Human    71 LLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVI 135

  Fly   126 NVLADMSGPGTMGLKGGTELFFVTS---------------------------------------- 150
            |:|||..|||.:|:.|.:..:|:||                                        
Human   136 NILADALGPGVVGIHGDSPYYFLTSGKIHLLSSLYPPSILVPDLIYWPSLRDFFGSTSQEPGRRS 200

  Fly   151 -----------AAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANELYTT 204
                       |....:||||||||.|:||:|.:...|..:|.||.|||..|.:|.|  |..|..
Human   201 GMYLLPISLPAAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFL--NPWYEA 263

  Fly   205 TLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            :||..|.||:..|:.||..|||:.||.::.:.|:
Human   264 SLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCR 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 109/280 (39%)
APH1AXP_024303223.1 Aph-1 3..284 CDD:310594 109/280 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C290034967
eggNOG 1 0.900 E1_KOG3972
Hieranoid 1 1.000
Homologene 1 1.000 H9345
Inparanoid 1 1.050 224 1.000 Inparanoid score I3465
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1085102at2759
OrthoFinder 1 1.000 FOG0001574
OrthoInspector 1 1.000 T609991
orthoMCL 1 0.900 OOG5_130831
Panther 1 1.100 O PTHR12889
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4469
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.