DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and Aph1a

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_006233039.1 Gene:Aph1a RGDID:1311546 Length:265 Species:Rattus norvegicus

Alignment Length:243 Identity:114/244 (47%)
Similarity:164/244 (67%) Gaps:12/244 (5%)


  Fly     6 FFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISS-LWYALIPLKE--------- 60
            ||||||:||||.||||:.|:|.||:|:|||:|.|||||:|||::| :|:.|:.:.:         
  Rat     6 FFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYG 70

  Fly    61 FLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISGMFALV 125
            .|.||...||..||.||:..|::|:..::||.:::||.|...:...:||||||.||||||:|:::
  Rat    71 LLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVI 135

  Fly   126 NVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFV 190
            |:|||..|||.:|:.|.:..:|:|||....:||||||||.|:||:|.:...|..:|.||.|||..
  Rat   136 NILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLT 200

  Fly   191 SLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            |.:|.|  |..|..:||..|.||:..|:.||..|||:.||.::.::|:
  Rat   201 SGLTFL--NPWYEASLLPIYAVTVSMGLWAFVTAGGSLRSIQRSLSCR 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 109/229 (48%)
Aph1aXP_006233039.1 Aph-1 3..233 CDD:283708 109/229 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C290042045
eggNOG 1 0.900 E1_KOG3972
Hieranoid 1 1.000
Homologene 1 1.000 H9345
Inparanoid 1 1.050 225 1.000 Inparanoid score I3358
OMA 1 1.010
OrthoDB 1 1.010 D1085102at2759
OrthoFinder 1 1.000 FOG0001574
OrthoInspector 1 1.000 T618918
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12889
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.