DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and Aph1b

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001040555.1 Gene:Aph1b RGDID:1562468 Length:257 Species:Rattus norvegicus

Alignment Length:249 Identity:116/250 (46%)
Similarity:166/250 (66%) Gaps:15/250 (6%)


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALI--------- 56
            ||.|.||||.||||||..||::||||.||:|:|.|||.|||||:|||:||:::.|:         
  Rat     1 MTAPVFFGCAFIAFGPALALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRDG 65

  Fly    57 PLKEF-LAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAV-AEDTRVTDNKHILAYVSGLGFGIIS 119
            |::.: |.|||:.|||.||.||...||:|:...:||.:: .|:|  ..:..:|||||||||||:|
  Rat    66 PVQNYLLIFGVLLSVCIQELFRLAYYRLLKKASEGLKSINPEET--APSMRLLAYVSGLGFGIMS 128

  Fly   120 GMFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVV 184
            |:|:.||.|::..||||:|:.|.:..||:.||...|.||:||.||.::||:..:.|.:..:..|:
  Rat   129 GVFSFVNTLSNALGPGTVGIHGDSPQFFLNSAFMTLVIIMLHVFWGIVFFDGCEKNKWYILLTVL 193

  Fly   185 FSHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            .:||.||..|||:.:  |...|:..|::.:|.|:.||.||||:.||.:..:.||
  Rat   194 LTHLLVSTQTLLSPH--YEVNLVTAYIIMVLMGIWAFCVAGGSRRSLKLCLLCQ 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 109/234 (47%)
Aph1bNP_001040555.1 Aph-1 2..232 CDD:283708 109/234 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C290034226
eggNOG 1 0.900 E1_KOG3972
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130831
Panther 1 1.100 LDO PTHR12889
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.