DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and Aph1b

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_006510985.1 Gene:Aph1b MGIID:3522097 Length:304 Species:Mus musculus

Alignment Length:294 Identity:116/295 (39%)
Similarity:164/295 (56%) Gaps:58/295 (20%)


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALI--------- 56
            ||...||||.||||||..||:|||||.||:|:|.|||.|||||:|||:||:::.|:         
Mouse     1 MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRDG 65

  Fly    57 PLKEF-LAFGVVFSVCFQEAFRYIIYRIL----------RSTEQGLH-AVAEDTRVTDNKHI--- 106
            |::.: |.|||:.|||.||.||...|::|          |..|.|.. :.|.:...|::::|   
Mouse    66 PVQNYLLIFGVLLSVCIQELFRLAYYKLLKELKNLGSSMRKREGGTRMSAATEENTTESQYIGDK 130

  Fly   107 --------------------------------LAYVSGLGFGIISGMFALVNVLADMSGPGTMGL 139
                                            |||||||||||:||:|:.||.|::..||||:|:
Mouse   131 DLRLWEVQNSKRKASEGLKSINPEETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSNSLGPGTVGI 195

  Fly   140 KGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANELYTT 204
            .|.:..||:.||...|.:|:||.||.|:||:..:.|.:..:..|:.:||.||..|.|  :..|..
Mouse   196 HGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDGCEKNKWYTLLTVLLTHLVVSTQTFL--SPYYEV 258

  Fly   205 TLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            .|:..|::.:|.|:.||.||||:.||.:..:.||
Mouse   259 NLVTAYIIMVLMGIWAFYVAGGSCRSLKLCLLCQ 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 109/279 (39%)
Aph1bXP_006510985.1 Aph-1 2..279 CDD:283708 109/279 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C290036998
eggNOG 1 0.900 E1_KOG3972
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3465
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1085102at2759
OrthoFinder 1 1.000 FOG0001574
OrthoInspector 1 1.000 T616801
orthoMCL 1 0.900 OOG5_130831
Panther 1 1.100 LDO PTHR12889
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4469
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.