DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and aph-1

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_492469.1 Gene:aph-1 WormBaseID:WBGene00000147 Length:308 Species:Caenorhabditis elegans

Alignment Length:250 Identity:74/250 (30%)
Similarity:122/250 (49%) Gaps:27/250 (11%)


  Fly     9 CTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSL-WYAL-IPLKEFLAFGVVFSVC 71
            |...:|.|..|||...||:||||||:....:||||:|||.||| |..| ..|.:.....:...:.
 Worm     9 CYIASFSPSIALFCSFIAHDPVRIILFFLGSFFWLVSLLFSSLAWLGLSTVLPDTFLLSLTVCII 73

  Fly    72 FQEAFRYIIYRILRSTEQGLHAVAEDTRVT---------DNKHILAYVSGLGFGIISGMFALVNV 127
            .||..|...:.:|:..::||:.:....:::         :.:|:||.|.|||.|:||.:|..:|.
 Worm    74 AQELSRVAYFMLLKKAQRGLNKITRQGQISVAPGVSDLHNARHMLALVCGLGMGVISALFYTMNA 138

  Fly   128 LADMSGPGTMGLKGGTELFFV-TSAA----------QALSIILLHTFWSVIFFNAFDTNNYIHIG 181
            .|..|||||:||....:...: |:.|          .|:.:.|.|..|:::.:::......|...
 Worm   139 FAIFSGPGTIGLPNALKTGEIDTNRAGKYLPLCYTLSAILLTLFHVTWTIMVWDSCHKIGRIPSA 203

  Fly   182 YV-----VFSHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSF 231
            :|     |.|||.|:.::.||:...:.....:.:|:.::.......:.|||..||
 Worm   204 FVPGAAAVVSHLLVTFLSSLNSRGFHVLVFAVQFLILLICIAYCNVIMGGTISSF 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 69/243 (28%)
aph-1NP_492469.1 Aph-1 7..252 CDD:283708 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289453227
eggNOG 1 0.900 E1_KOG3972
Hieranoid 1 1.000
Homologene 1 1.000 H9345
Inparanoid 1 1.050 114 1.000 Inparanoid score I3374
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1085102at2759
OrthoFinder 1 1.000 FOG0001574
OrthoInspector 1 1.000 T475775
orthoMCL 1 0.900 OOG5_130831
Panther 1 1.100 LDO PTHR12889
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4469
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.