DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: aph-1 and LOC108348064

Sequence 1:NP_001259963.1 Gene:aph-1 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_017451568.1 Gene:LOC108348064 RGDID:11363519 Length:257 Species:Rattus norvegicus

Alignment Length:249 Identity:116/250 (46%)
Similarity:166/250 (66%) Gaps:15/250 (6%)


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALI--------- 56
            ||.|.||||.||||||..||::||||.||:|:|.|||.|||||:|||:||:::.|:         
  Rat     1 MTAPVFFGCAFIAFGPALALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRDG 65

  Fly    57 PLKEF-LAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAV-AEDTRVTDNKHILAYVSGLGFGIIS 119
            |::.: |.|||:.|||.||.||...||:|:...:||.:: .|:|  ..:..:|||||||||||:|
  Rat    66 PVQNYLLIFGVLLSVCIQELFRLAYYRLLKKASEGLKSINPEET--APSMRLLAYVSGLGFGIMS 128

  Fly   120 GMFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVV 184
            |:|:.||.|::..||||:|:.|.:..||:.||...|.||:||.||.::||:..:.|.:..:..|:
  Rat   129 GVFSFVNTLSNALGPGTVGIHGDSPQFFLNSAFMTLVIIMLHVFWGIVFFDGCEKNKWYILLTVL 193

  Fly   185 FSHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            .:||.||..|||:.:  |...|:..|::.:|.|:.||.||||:.||.:..:.||
  Rat   194 LTHLLVSTQTLLSPH--YEVNLVTAYIIMVLMGIWAFCVAGGSRRSLKLCLLCQ 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 109/234 (47%)
LOC108348064XP_017451568.1 Aph-1 2..232 CDD:283708 109/234 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.