DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT5G43200

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_199134.1 Gene:AT5G43200 / 834338 AraportID:AT5G43200 Length:207 Species:Arabidopsis thaliana


Alignment Length:50 Identity:17/50 - (34%)
Similarity:26/50 - (52%) Gaps:3/50 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EENK-CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQR-NKTCPICK 132
            ||:| |.||......:.|:..:. .|.|.|...|:..:|.| |.:||:|:
plant   151 EESKTCAICLEELSTSDDYCELP-NCTHCFHEPCLTQWLIRGNNSCPLCR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 17/49 (35%)
AT5G43200NP_199134.1 RING_Ubox 152..202 CDD:473075 16/48 (33%)

Return to query results.
Submit another query.