DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and AT5G37270

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_198543.1 Gene:AT5G37270 AraportID:AT5G37270 Length:208 Species:Arabidopsis thaliana

Alignment Length:142 Identity:36/143 (25%)
Similarity:64/143 (45%) Gaps:21/143 (15%)


  Fly     9 MTKKKLIVEVIKQRKRNKEKDEIIKD-SFESKKRLIDLRLQLDKEK-----------NITKELRL 61
            |||.:|....:......::.||.|.| .|   .||:..|:.||...           .:|:::.|
plant    59 MTKIELKPSCLTSHHIYQDLDEFITDIEF---CRLLSERIALDCAHIPQPFSVSFYVRVTRDVML 120

  Fly    62 ---RLAAQDAIANQAENLSMKRKKIA--EENKCYICKWNYEVTGDHRPVSI-KCGHLFGANCILH 120
               .:.::|......|..:|:...:.  ||..|.||..::..:.|...:.: .|.|||..:||..
plant   121 PSIAVPSRDMFQRLLEEQTMEFTDLGDEEETTCSICLEDFSESHDDNIILLPDCFHLFHQSCIFE 185

  Fly   121 YLQRNKTCPICK 132
            :|:|.::||:|:
plant   186 WLKRQRSCPLCR 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 15/46 (33%)
AT5G37270NP_198543.1 zf-rbx1 147..197 CDD:289448 17/50 (34%)
zf-RING_2 152..197 CDD:290367 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2623
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.960

Return to query results.
Submit another query.