DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT5G37250

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001330830.1 Gene:AT5G37250 / 833699 AraportID:AT5G37250 Length:208 Species:Arabidopsis thaliana


Alignment Length:141 Identity:34/141 - (24%)
Similarity:62/141 - (43%) Gaps:19/141 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLIDLRLQLDKEK-----------NITKEL--- 59
            |||.:|....:......::.||.|  :.....||:..|:.||...           .:|:::   
plant    59 MTKIELKPSCLSSHHIYQDLDEFI--THTEFCRLLSERIVLDCAHIPQPFSVSLYVEVTRDVMFS 121

  Fly    60 RLRLAAQDAIANQAENLSMKRKKIA--EENKCYICKWNYEVTGDHRPVSI-KCGHLFGANCILHY 121
            .:.:.:.|......|..:|:...:.  ||..|.||..::..:.|...:.: .|.|||..|||..:
plant   122 SIAVRSTDTFQRLLEEQTMELTDLGDEEETTCSICLEDFSESHDDNIILLPDCFHLFHQNCIFEW 186

  Fly   122 LQRNKTCPICK 132
            |:|.::||:|:
plant   187 LKRQRSCPLCR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 18/49 (37%)
AT5G37250NP_001330830.1 HRD1 <86..>198 CDD:227568 27/112 (24%)
RING-H2_PA-TM-RING 152..197 CDD:438118 15/44 (34%)

Return to query results.
Submit another query.