DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and AT5G03450

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_195965.2 Gene:AT5G03450 AraportID:AT5G03450 Length:630 Species:Arabidopsis thaliana

Alignment Length:155 Identity:36/156 (23%)
Similarity:79/156 (51%) Gaps:12/156 (8%)


  Fly     2 DKQDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLID-----LRLQLDKEKNITKELRL 61
            :::|..:..:::..|:..:.::.::|::| .:||....:..||     :|:..::.:.|..:.|.
plant    31 EEEDEEEEDEEEAYVDYGEVQEEDEEEEE-EEDSERQTREYIDVLDSPVRVSQNESEGIENQNRS 94

  Fly    62 RLAAQDAIANQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNK 126
            :.....:..:| |::..|:.. .|...|.||...:...|.|:...:.||||:|.:||..:.|:.:
plant    95 QGVCSSSSGSQ-EDVEWKQGD-TEGLSCSICMEVWTSGGQHQVCCLPCGHLYGYSCINKWFQQRR 157

  Fly   127 T---CPICKSQMIRCMDVRIIIAGQ 148
            :   ||:| :::....|||.|.|.:
plant   158 SGGKCPLC-NKICSLRDVRKIYASR 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 16/48 (33%)
AT5G03450NP_195965.2 zf-RING_2 119..165 CDD:290367 15/46 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1451258at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16047
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.