DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT5G03450

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_195965.2 Gene:AT5G03450 / 831835 AraportID:AT5G03450 Length:630 Species:Arabidopsis thaliana


Alignment Length:155 Identity:36/155 - (23%)
Similarity:79/155 - (50%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKQDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLID-----LRLQLDKEKNITKELRL 61
            :::|..:..:::..|:..:.::.::|::| .:||....:..||     :|:..::.:.|..:.|.
plant    31 EEEDEEEEDEEEAYVDYGEVQEEDEEEEE-EEDSERQTREYIDVLDSPVRVSQNESEGIENQNRS 94

  Fly    62 RLAAQDAIANQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNK 126
            :.....:..:| |::..|:.. .|...|.||...:...|.|:...:.||||:|.:||..:.|:.:
plant    95 QGVCSSSSGSQ-EDVEWKQGD-TEGLSCSICMEVWTSGGQHQVCCLPCGHLYGYSCINKWFQQRR 157

  Fly   127 T---CPICKSQMIRCMDVRIIIAGQ 148
            :   ||:| :::....|||.|.|.:
plant   158 SGGKCPLC-NKICSLRDVRKIYASR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 15/47 (32%)
AT5G03450NP_195965.2 mRING-C3HGC3_RFWD3 116..166 CDD:319364 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.