DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT2G24480

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_180024.1 Gene:AT2G24480 / 816984 AraportID:AT2G24480 Length:198 Species:Arabidopsis thaliana


Alignment Length:49 Identity:12/49 - (24%)
Similarity:23/49 - (46%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHY-LQRNKTCPICK 132
            |...|.||..|...:.::..:.. |.|.:...|:..: :..|.:||:|:
plant   146 ESETCAICLENMSRSENYCQMPY-CKHCYHEGCVTKWVIGHNNSCPLCR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 12/49 (24%)
AT2G24480NP_180024.1 COG5540 <150..196 CDD:227827 11/45 (24%)

Return to query results.
Submit another query.