DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and AT2G24480

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_180024.1 Gene:AT2G24480 AraportID:AT2G24480 Length:198 Species:Arabidopsis thaliana

Alignment Length:49 Identity:12/50 (24%)
Similarity:23/50 (46%) Gaps:2/50 (4%)


  Fly    85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHY-LQRNKTCPICK 132
            |...|.||..|...:.::..:.. |.|.:...|:..: :..|.:||:|:
plant   146 ESETCAICLENMSRSENYCQMPY-CKHCYHEGCVTKWVIGHNNSCPLCR 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 11/46 (24%)
AT2G24480NP_180024.1 RING 149..196 CDD:238093 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2623
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.