DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT2G24480

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_180024.1 Gene:AT2G24480 / 816984 AraportID:AT2G24480 Length:198 Species:Arabidopsis thaliana


Alignment Length:49 Identity:12/49 - (24%)
Similarity:23/49 - (46%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHY-LQRNKTCPICK 132
            |...|.||..|...:.::..:.. |.|.:...|:..: :..|.:||:|:
plant   146 ESETCAICLENMSRSENYCQMPY-CKHCYHEGCVTKWVIGHNNSCPLCR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 10/45 (22%)
AT2G24480NP_180024.1 COG5540 <150..196 CDD:227827 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.