DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and RFWD3

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001357463.1 Gene:RFWD3 HGNCID:25539 Length:774 Species:Homo sapiens

Alignment Length:63 Identity:23/64 (36%)
Similarity:37/64 (58%) Gaps:2/64 (3%)


  Fly    85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQ-RNKTCPICKSQMIRCMDVRIIIA 146
            |.:.|.||...:...||||..:::||||||..||..:|: :.:.||.| ::..|..|:.::.|
Human   283 EGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQC-NKKARHSDIVVLYA 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 19/46 (41%)
RFWD3NP_001357463.1 WD 1 495..537
WD 2 539..577
WD 3 583..628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329678299
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16047
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.