DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and dgrn

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_649596.1 Gene:dgrn FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster

Alignment Length:147 Identity:37/148 (25%)
Similarity:54/148 (36%) Gaps:23/148 (16%)


  Fly    16 VEVIK----------QRKRNKEKDEIIKDSFESKKRLIDLRLQLDKEKNITKELRLRLAAQDAIA 70
            ||||.          :..||::.|..|........|...:.|..:....|   |..|.|..|.:.
  Fly   179 VEVIDLSHLDRAPPVRSARNRDPDAFIDLCTPEGPRSRTVNLHSNDSLTI---LPRRSAENDPVV 240

  Fly    71 N-------QAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTC 128
            :       :..|..:...:..|..||.||   .:......|||.||||:|...||...::....|
  Fly   241 DLDVASPPKRVNRDIDESQKEELYKCPIC---MDSVSKREPVSTKCGHVFCRECIETAIRATHKC 302

  Fly   129 PICKSQMIRCMDVRIII 145
            |||..::......||.:
  Fly   303 PICNKKLTARQFFRIYL 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 18/45 (40%)
dgrnNP_649596.1 RING 266..305 CDD:214546 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001388
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.